PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn131841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 310aa    MW: 33814.8 Da    PI: 8.6695
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn131841genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.32.6e-65141481139
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 gg++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny lpk++DnneVlkALc+eAGw ve+DGttyrkg+kp+  ae++g+s++++p+ss++ s+ 
  Achn131841  14 GGGRRKPSWRERENNRRRERRRRAVAAKIYSGLRAQGNYDLPKHCDNNEVLKALCAEAGWNVEPDGTTYRKGCKPT-LAEIGGTSTNITPCSSQNPSPP 111
                 689*************************************************************************.********************** PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpv 139
                 ss+++sp++sy++sp+ ssfp ps++d++ +++   ++ +
  Achn131841 112 SSSFPSPIPSYQPSPSLSSFPGPSRFDNNASSQ---MFAF 148
                 ***************************997753...3333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.0E-6115143IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MWEGESDAAA TTGGGGRRKP SWRERENNRR RERRRRAVAA KIYSGLRAQG NYDLPKHCDN  60
NEVLKALCAE AGWNVEPDGT TYRKGCKPTL AEIGGTSTNI TPCSSQNPSP PSSSFPSPIP  120
SYQPSPSLSS FPGPSRFDNN ASSQMFAFLR NAIPSSLPPL RISNSAPVTP PLSSPTSRPP  180
HKKPNWESIA SLSNYPCFAA SAPASPTRCR QIFPATIPEC DESDTSTVDS GQWMRFQNFA  240
PAMIPTSPTF NLVRPVAQRV YPMDAMTEKG KGLEFEFENI PVKAWEGERI HEVGVDDLEL  300
TLGSGKTRN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11635RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-135PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-120BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A061FCF51e-129A0A061FCF5_THECC; Brassinosteroid signaling positive regulator family protein
STRINGPGSC0003DMT4000398791e-125(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-96BES1 family protein